PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C012909P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family SBP
Protein Properties Length: 1014aa    MW: 111471 Da    PI: 6.0943
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C012909P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1322.1e-41155232178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +Cqve+C adls+ak+yhrrhkvCe+hska+++lv++++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk ++
  MELO3C012909P1 155 VCQVEDCGADLSNAKDYHRRHKVCETHSKASNALVANVMQRFCQQCSRFHVLQEFDEGKRSCRRRLAGHNKRRRKINP 232
                     6**************************************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.0E-33149217IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.017153230IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.4E-38154235IPR004333Transcription factor, SBP-box
PfamPF031104.5E-30156229IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.40.202.5E-8311338IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484033.91E-8781895IPR020683Ankyrin repeat-containing domain
CDDcd002041.10E-6785913No hitNo description
Gene3DG3DSA:1.25.40.202.5E-8785913IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1014 aa     Download sequence    Send to blast
MEAGYGGEAC QLYGMGTMDL RAAVGKRNLE WDLNDWKWDG DLFIARPLNT VESGHLSRQL  60
FPIVSGIPLT NGGSSNSSSS CSDEANMGIE KGKREVEKRR RVTVIEDDNL NDEARNLSLK  120
VGGNGSQIVE RDAGSWEGTS GKKTKLAGGN SNRAVCQVED CGADLSNAKD YHRRHKVCET  180
HSKASNALVA NVMQRFCQQC SRFHVLQEFD EGKRSCRRRL AGHNKRRRKI NPDNVVNGNS  240
PPDEQTSSYL LLTLLRILAN LHSNGSNQTT DQDLLSHLIR SLACQSSEHG RKNLSGILHE  300
PQNLLNNGSL SGKSDLVSTF LSNGPQVPLR SSKQHDTPIP ETPAQAIGRG GDTPAISSIK  360
PSTSNSPPAY SEIRDSTVGQ CKMMNFDLND AYVDSDDGME DIERQTLPVH MGTSSLECPS  420
WVQQDSHQSS PPQTSGNSDS ASAQSPSSSA GEAQSRTDRI ILKLFGKAPN DFPHVLRAQV  480
LDWLSHSPTE IESYIRPGCV ILTIYLRQTE AAWDNLCHDL STSFNRLLDV SDDAFWKTGW  540
VYVRVQHQIA FVYHGQVVVD TSLPLRNNNY CRITSVNPVA VSTSKKAIFS VKGINLSQPT  600
TRLLCAIEGK YLTQEASDES TESDDNLKAQ DDSLCVTFSC SIPVVYGRGF IEVEDDGFSS  660
SSFPFIVAEE DVCSEICSLQ SALELTETCS NSGETAELEG RSNAMEFIHE IGWLFHRNQL  720
KSRLGHLDPN ENLFSLPRFK WLMEFSMDHD WCAVVKKLLD ILQDGTVDAG GHPSLNLALM  780
EMGLLHRAVR KNSRSLVELL LRYPSKVNDA SSSEDSASVD GETDSFLFRP NVVGPAGLTP  840
LHIAAGKDDS EDVLDALTND PGMVGIEAWK SARDSTGSTP EDYARLRGHY SYIRLVQRKI  900
NKRSAAGHVV LDIPSSLSDG SWNQKQNTDF TSSRFEIGRT ELKPSQQHCK LCVRKPLGCG  960
TSSSASLVYR PAMLSMVAIA AVCVCVALLF KSSPEVLYVF RPFRWELLDY GTS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-32149229484squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
197101KRRRV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00633PBMTransfer from PK06791.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818270.0LN681827.1 Cucumis melo genomic scaffold, anchoredscaffold00018.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008447446.10.0PREDICTED: squamosa promoter-binding-like protein 12
SwissprotQ9S7P50.0SPL12_ARATH; Squamosa promoter-binding-like protein 12
TrEMBLA0A0A0LEQ20.0A0A0A0LEQ2_CUCSA; Uncharacterized protein
STRINGPOPTR_0002s18970.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15393495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60030.10.0squamosa promoter-binding protein-like 12